Website stats for Speakenglishwithtiffani - speakenglishwithtiffani.com
I'd been learning English since I was a kid but then I got to a point where I wasn't improving and didn't know how to overcome that. So, I started to look on youtube for videos on how to learn English and that was then when I found the "Speak English With Tiffani" youtube channel.
speakenglishwithtiffani.com was registered 8 years 6 months ago. It has a alexa rank of #227,324 in the world. It is a domain having .com extension. It is estimated worth of $ 41,040.00 and have a daily income of around $ 76.00. As no active threats were reported recently, speakenglishwithtiffani.com is SAFE to browse.
Traffic Report
| Daily Unique Visitors: | 6,750 |
| Daily Pageviews: | 27,000 |
Estimated Valuation
| Income Per Day: | $ 76.00 |
| Estimated Worth: | $ 41,040.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: |
 Very Poor
|
| WOT Privacy: |
Very Poor
|
| WOT Child Safety: |
Very Poor
|
Website Ranks & Scores
| Alexa Rank: | 227,324 |
| PageSpeed Score: | 89 ON 100 |
| Domain Authority: |
49 ON 100 
|
| Bounce Rate: | Not Applicable |
| Time On Site: | Not Applicable |
Web Server Information
Hosted IP Address:
45.60.98.114
Hosted Country:
US
Location Latitude:
37.5324Location Longitude:
-122.249Traffic Classification
| Total Traffic: | No Data |
| Direct Traffic: | No Data |
| Referral Traffic: | No Data |
| Search Traffic: | No Data |
| Social Traffic: | No Data |
| Mail Traffic: | No Data |
| Display Traffic: | No Data |
Search Engine Results For speakenglishwithtiffani.com
5 Simple Steps To Speak English In Real Life - YouTube
8 Sep 2019 ... Join the Speak English With Tiffani Academyhttps:// speakenglishwithtiffaniacademy.comWHAT YOU WILL LEARN IN THIS ENGLISH ...
English Teacher Tiffani (@speakenglishwithtiffani) • Instagram ...
- https://www.instagram.com/speakenglishwithtiffani/
74k Followers, 1 Following, 1072 Posts - See Instagram photos and videos from English Teacher Tiffani (@speakenglishwithtiffani)
Speak English With Tiffani – Telegram
New English vocabulary words, New English expressions, and tons of stories! https://www.speakenglishwithtiffani.com/episode140/ · Speak English with Tiffani.
Speak English With Tiffani Academy
Become a member of the "Speak English With Tiffani Academy" now and get access to all of the courses, monthly study plans, Ebooks, Audio series, and much ...
Speak English with Tiffani Podcast on Apple Podcasts
2 days ago ... Visit SpeakEnglishWithTiffani.com/Episode144 for show notes for this podcast episode. In today's episode, you will learn new English vocabulary ...
Speak English with Tiffani Podcast
Welcome to the Speak English with Tiffani podcast. A podcast especially created for Intermediate and Advanced English learners. In this podcast, you will learn ...
Speak English with Tiffani Podcast - Teacher Tiffani | Listen Notes
Welcome to the Speak English with Tiffani podcast. ... Visit SpeakEnglishWithTiffani.com/Episode144 for show notes for this podcast episode.In today's episode ...
Speak English with Tiffani Podcast - Education Podcast | Podchaser
144 episodes. Welcome to the Speak English with Tiffani podcast. A podcast especially created for Intermediate and Advanced English learners. In this podcast ...
Speak English with Tiffani Podcast – Podcast – Podtail
Welcome to the Speak English with Tiffani podcast. A podcast especially created for Intermediate and Advanced English learners. In this podcast, you will learn ...
Speak English with Tiffani
So, I started to look on youtube for videos on how to learn English and that was then when I found the "Speak English With Tiffani" youtube channel. I watched ...
Speak English with Tiffani Podcast | Free Listening on Podbean App
Welcome to the Speak English with Tiffani podcast. A podcast especially created for Intermediate and Advanced English learners. In this podcast, you will learn.
Speak English with Tiffani Podcast - Buzzsprout
Welcome to the Speak English with Tiffani podcast. A podcast especially created for Intermediate and Advanced English learners. In this podcast, you will learn ...
132 : Topical English | "Electric Cars" Part 2 - Buzzsprout
14 Apr 2021 ... Visit SpeakEnglishWithTiffani.com/Episode132 for show notes and the LIVE video link for this podcast episode.In today's episode, I continue my ...
Speak English With Tiffani YouTube Channel Analytics Report ...
Provides a report on the performance of the Speak English With Tiffani channel's subscriber ranking, average views, Super Chat revenue, and paid advertising ...
Speak English With Tiffani - YouTube in 2021 | English logo ...
Speak English With Tiffani · Have you studied English for years but still can't speak? If so, this channel is for you!This YouTube channel will teach you how to .....
Pin by Vicanvictoredg on Mis Pines guardados | English sentences ...
... by Vicanvictoredg. How to make long sentences in English - Speak English with Tiffani Sentence Examples, English. Article from speakenglishwithtiffani.com ...
"How to organize your thoughts and answer any question in English ...
Welcome to Speak English with Tiffani. I am Teacher Tiffani and ... How can you contact me? [email protected]. Schedule. Choose the time for ...
HowToExpressYourselfConfidentlyInEnglishEpisode1 - StudyLib
SPEAKENGLISHWITHTIFFANI.COM TEACHER TIFFANI HOW TO EXPRESS YOURSELF CONFIDENTLY IN ENGLISH | EPISODE 1 - RELATIONSHIPS In this ...
Speak English with Tiffani Podcast podcast by Teacher Tiffani
Listen to Speak English with Tiffani Podcast podcast by Teacher Tiffani. More than 1 million podcasts online for free on mytuner-radio.com.
Speak English with Tiffani Podcasts | All & Latest Episodes - OwlTail
Visit SpeakEnglishWithTiffani.com/Episode143 for show notes for this podcast episode.In today's episode, you will learn new English vocabulary words and ...
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | 5 |
| H3 Headings: | 14 | H4 Headings: | Not Applicable |
| H5 Headings: | 6 | H6 Headings: | Not Applicable |
| Total IFRAMEs: | 1 | Total Images: | 1 |
| Google Adsense: | Not Applicable | Google Analytics: | UA-85725237-1 |
Two Phrase Analysis
| Words | Occurrences | Density | Possible Spam |
|---|---|---|---|
| her Academy | 6 | 0.626 % | No |
| that I | 5 | 0.521 % | No |
| help you | 5 | 0.521 % | No |
| all the | 4 | 0.417 % | No |
| Teacher Tiffani | 4 | 0.417 % | No |
| I found | 4 | 0.417 % | No |
| helped me | 4 | 0.417 % | No |
| in her | 4 | 0.417 % | No |
| This section | 4 | 0.417 % | No |
| section will | 4 | 0.417 % | No |
| will help | 4 | 0.417 % | No |
| I can | 4 | 0.417 % | No |
| able to | 3 | 0.313 % | No |
| I was | 3 | 0.313 % | No |
| improve your | 3 | 0.313 % | No |
| for me | 3 | 0.313 % | No |
| and more | 3 | 0.313 % | No |
| YouTube channel | 3 | 0.313 % | No |
| her YouTube | 3 | 0.313 % | No |
| and I | 3 | 0.313 % | No |
Four Phrase Analysis
| Words | Occurrences | Density | Possible Spam |
|---|---|---|---|
| section will help you | 4 | 0.417 % | No |
| This section will help | 4 | 0.417 % | No |
| help you improve your | 2 | 0.209 % | No |
| you improve your English | 2 | 0.209 % | No |
| improve your English fluency | 2 | 0.209 % | No |
| will help you improve | 2 | 0.209 % | No |
| Now I feel more | 2 | 0.209 % | No |
| I’m very thankful for | 2 | 0.209 % | No |
| lot of her videos | 1 | 0.104 % | No |
| her YouTube channel and | 1 | 0.104 % | No |
| of her videos That's | 1 | 0.104 % | No |
| her videos That's where | 1 | 0.104 % | No |
| a lot of her | 1 | 0.104 % | No |
| I watched a lot | 1 | 0.104 % | No |
| channel and I watched | 1 | 0.104 % | No |
| videos That's where I | 1 | 0.104 % | No |
| YouTube channel and I | 1 | 0.104 % | No |
| and I watched a | 1 | 0.104 % | No |
| watched a lot of | 1 | 0.104 % | No |
| found out about her | 1 | 0.104 % | No |
HTTP Header Analysis
Status-Code: 200
Status: 200 OK
Date: Sun, 04 Apr 2021 20:55:08 GMT
Server: nginx/1.19.5
Content-Type: text/html; charset=UTF-8
Vary: Accept-Encoding,Cookie
Cache-Control: max-age=3, must-revalidate
Content-Encoding: gzip
Last-Modified: Sun, 04 Apr 2021 20:55:07 GMT
host-header: c2hhcmVkLmJsdWVob3N0LmNvbQ==
X-Server-Cache: true
X-Proxy-Cache: EXPIRED
X-CDN: Imperva
Transfer-Encoding: chunked
X-Iinfo: 9-237515363-237515399 NNNN CT(125 124 0) RT(1617569707415 174) q(0 0 3 3) r(4 7) U12
Domain Information
| Domain Registrar: |
NameCheap, Inc.
|
|---|---|
| Registration Date: | 2016-05-17 8 years 6 months 4 days ago |
| Last Modified: | 2020-04-17 4 years 7 months 1 day ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.bluehost.com | |
162.159.24.80 | United States |
| ns2.bluehost.com | |
162.159.25.175 | United States |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| speakenglishwithtiffani.com | A | 14392 |
IP: 45.60.98.114 |
| speakenglishwithtiffani.com | A | 14392 |
IP: 45.60.22.114 |
| speakenglishwithtiffani.com | NS | 86400 |
Target: ns2.bluehost.com |
| speakenglishwithtiffani.com | NS | 86400 |
Target: ns1.bluehost.com |
| speakenglishwithtiffani.com | SOA | 86400 |
MNAME: ns1.bluehost.com RNAME: root.box5535.bluehost.com Serial: 2021031200 Refresh: 86400 Retry: 7200 Expire: 3600000 |
| speakenglishwithtiffani.com | MX | 14400 |
Target: mail.speakenglishwithtiffani.com |
| speakenglishwithtiffani.com | TXT | 14400 |
TXT: v=spf1 a mx ptr include:bluehost.com ?all |
| speakenglishwithtiffani.com | TXT | 14400 |
TXT: _globalsign-domain-verification=Mp4qc3oo Emz6n-xW8IY9xtDbq4KIfl6LUdjT5UKw1w |
| speakenglishwithtiffani.com | TXT | 14400 |
TXT: include:emsd1.com |
| speakenglishwithtiffani.com | TXT | 300 |
TXT: google-site-verification=UIgBwtgIWRKv2qJ -xdpqVPJuzAjXUD9fMfAdrfMoG7U |
Full WHOIS Lookup
Registry Domain ID:
2028864775_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.namecheap.com
Registrar URL:
http://www.namecheap.com
Updated Date:
2020-04-17T07:28:27Z
Creation Date:
2016-05-17T07:11:49Z
Registry Expiry Date:
2021-05-17T07:11:49Z
Registrar: NameCheap, Inc.
Registrar IANA
ID: 1068
Registrar Abuse Contact Email:
[email protected]
Registrar Abuse Contact Phone:
+1.6613102107
Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited
Name Server:
NS1.BLUEHOST.COM
Name Server: NS2.BLUEHOST.COM
DNSSEC:
unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/
>>> Last update of whois database:
2021-04-04T20:54:54Z
Similarly Ranked Websites
We Rock Your Web
We bring tech talk into layman terms - learn how to build a website, rank it in Google, market it on social media, analyze traffic, and increase sales.
227,330 
$ 41,040.00
Canlı Mobese izle,Türkiye Dünyadan Trafik Kameraları
Türkiye ve Dünyadan Canli Mobese kameraları izle.Mobese izle Canlı Trafik Kameraları ibb kamera Güvenlik kamerası Şehir live webcam
227,336 $ 41,040.00
Suki Desu - Curiosidades Sobre O Japão E O Idioma Japonês
Conheça um dos maiores portais sobre o Japão e idioma japonês! Curiosidades, culinária, turismo, cultura e etc.
227,336 $ 41,040.00
EcoMENA - Environmental Hub in MENA
EcoMENA is a volunteer-driven initiative to create mass environmental awareness and to foster sustainability worldwide, MENA in particular.
227,339 $ 41,040.00
Grid
Calzado e indumentaria Nike, Adidas, Reebok, New Balance y más. Hacemos envíos a todo el país. ¡Pagá en cuotas sin interés!
227,341 $ 41,040.00